FGF2 (NM_002006) Human Recombinant Protein
CAT#: TP317426
Recombinant protein of human fibroblast growth factor 2 (basic) (FGF2), 20 µg
View other "FGF2" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217426 representing NM_002006
Red=Cloning site Green=Tags(s) MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRT EERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSIT TLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGV CANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAIL FLPMSAKS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001997 |
Locus ID | 2247 |
UniProt ID | P09038 |
Cytogenetics | 4q28.1 |
Refseq Size | 6803 |
Refseq ORF | 864 |
Synonyms | BFGF; FGF-2; FGFB; HBGF-2 |
Summary | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400733 | FGF2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400733 | Transient overexpression lysate of fibroblast growth factor 2 (basic) (FGF2) |
USD 436.00 |
|
PH317426 | FGF2 MS Standard C13 and N15-labeled recombinant protein (NP_001997) |
USD 3,255.00 |
|
TP723719 | Purified recombinant protein of Human fibroblast growth factor 2 (basic) (FGF2) |
USD 225.00 |
|
TP750002 | Recombinant protein of human Fibroblast Growth Factor-basic (FGF2) produced in E. coli |
USD 515.00 |
{0} Product Review(s)
Be the first one to submit a review