SMAD3 (NM_005902) Human Recombinant Protein
CAT#: TP308749
Recombinant protein of human SMAD family member 3 (SMAD3), transcript variant 1, 20 µg
View other "SMAD3" proteins (6)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208749 representing NM_005902
Red=Cloning site Green=Tags(s) MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRS LDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLV PRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPN PMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRN AAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAA LLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR CSSVS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.9 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | SMAD3 Activity Verified in a DNA-binding Assay: SMAD3 (TP308749) activity was measured in a colorimetric DNA-binding assay. Purified SMAD3 protein containing a C-terminal MYC/DDK tag was incubated with biotinylated double-stranded oligonucleotide containing the SMAD3 consensus DNA-binding sequence. Following incubation, the reaction was transferred to a streptavidin-coated microplate to allow capture of the DNA-protein complex. After washing, the captured protein was detected with an anti-DDK peroxidase conjugate and colorimetric signal detection with TMB. Specificity of the protein-DNA interaction was confirmed by carrying out the binding in the presence of an unlabeled competitor oligonucleotide and by comparison to binding to an oligonucleotide containing a mutation in the consensus binding sequence. |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005893 |
Locus ID | 4088 |
UniProt ID | P84022, A0A024R5Z3, Q9P0T0 |
Cytogenetics | 15q22.33 |
Refseq Size | 6256 |
Refseq ORF | 1275 |
Synonyms | HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3 |
Summary | The SMAD family of proteins are a group of intracellular signal transducer proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. The SMAD3 protein functions in the transforming growth factor-beta signaling pathway, and transmits signals from the cell surface to the nucleus, regulating gene activity and cell proliferation. It also functions as a tumor suppressor. Mutations in this gene are associated with aneurysms-osteoarthritis syndrome and Loeys-Dietz Syndrome 3. [provided by RefSeq, Nov 2019] |
Protein Families | Cancer stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Stem cell relevant signaling - JAK/STAT signaling pathway, Stem cell relevant signaling - TGFb/BMP signaling pathway, Transcription Factors |
Protein Pathways | Adherens junction, Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Pancreatic cancer, Pathways in cancer, TGF-beta signaling pathway, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401784 | SMAD3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428691 | SMAD3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401784 | Transient overexpression lysate of SMAD family member 3 (SMAD3), transcript variant 1 |
USD 436.00 |
|
LY428691 | Transient overexpression lysate of SMAD family member 3 (SMAD3), transcript variant 3 |
USD 436.00 |
|
PH308749 | SMAD3 MS Standard C13 and N15-labeled recombinant protein (NP_005893) |
USD 3,255.00 |
|
TP762386 | Purified recombinant protein of Human SMAD family member 3 (SMAD3), transcript variant 1, Ser2-Ala230, with N-terminal His tag, expressed in E.coli, 50ug |
USD 249.00 |
{0} Product Review(s)
Be the first one to submit a review