cIAP2 (BIRC3) (NM_001165) Human Recombinant Protein
CAT#: TP307764
Recombinant protein of human baculoviral IAP repeat-containing 3 (BIRC3), transcript variant 1, 20 µg
View other "cIAP2" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207764 protein sequence
Red=Cloning site Green=Tags(s) MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCG LMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSN SPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWPLTFLSPTDLAKAGFYYIGPGDRVACFACGG KLSNWEPKDNAMSEHLRHFPKCPFIENQLQDTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAG FYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSD SPGDENAESSIIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDL LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHDVIKQKTQTSL QARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVSDLPVEEQLRRLQEERTCKVC MDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 68.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001156 |
Locus ID | 330 |
UniProt ID | Q13489 |
Cytogenetics | 11q22.2 |
Refseq Size | 6932 |
Refseq ORF | 1812 |
Synonyms | AIP1; API2; c-IAP2; CIAP2; HAIP1; HIAP1; IAP-1; MALT2; MIHC; RNF49 |
Summary | This gene encodes a member of the IAP family of proteins that inhibit apoptosis by binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2, probably by interfering with activation of ICE-like proteases. The encoded protein inhibits apoptosis induced by serum deprivation but does not affect apoptosis resulting from exposure to menadione, a potent inducer of free radicals. It contains 3 baculovirus IAP repeats and a ring finger domain. Transcript variants encoding the same isoform have been identified. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Apoptosis, Focal adhesion, NOD-like receptor signaling pathway, Pathways in cancer, Small cell lung cancer, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405280 | BIRC3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420093 | BIRC3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY405280 | Transient overexpression lysate of baculoviral IAP repeat-containing 3 (BIRC3), transcript variant 2 |
USD 436.00 |
|
LY420093 | Transient overexpression lysate of baculoviral IAP repeat-containing 3 (BIRC3), transcript variant 1 |
USD 436.00 |
|
PH307764 | BIRC3 MS Standard C13 and N15-labeled recombinant protein (NP_001156) |
USD 3,255.00 |
|
PH311599 | BIRC3 MS Standard C13 and N15-labeled recombinant protein (NP_892007) |
USD 3,255.00 |
|
TP311599 | Recombinant protein of human baculoviral IAP repeat-containing 3 (BIRC3), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review