BACE2 (NM_012105) Human Recombinant Protein
CAT#: TP304860
Recombinant protein of human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, 20 µg
View other "BACE2" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204860 representing NM_012105
Red=Cloning site Green=Tags(s) MGALARALLLPLLAQWLLRAAPELAPAPFTLPLRVAAATNRVVAPTPGPGTPAERHADGLALALEPALAS PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAGTPHSYIDTYFDTERSSTYRS KGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIATIFESENFFLPGIKWNGILGLAYATLAKPSSS LETFFDSLVTQANIPNVFSMQMCGAGLPVAGSGTNGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILK LEIGGQSLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSET PWSYFPKISIYLRDENSSRSFRITILPQLYIQPMMGAGLNYECYRFGISPSTNALVIGATVMEGFYVIFD RAQKRVGFAASPCAEIAGAAVSEISGPFSTEDVASNCVPAQSLSEPILWIVSYALMSVCGAILLVLIVLL LLPFRCQRRPRDPEVVNDESSLVRHRWK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 49.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036237 |
Locus ID | 25825 |
UniProt ID | Q9Y5Z0 |
Cytogenetics | 21q22.2-q22.3 |
Refseq Size | 2993 |
Refseq ORF | 1554 |
Synonyms | AEPLC; ALP56; ASP1; ASP21; BAE2; CDA13; CEAP1; DRAP |
Summary | This gene encodes an integral membrane glycoprotein that functions as an aspartic protease. The encoded protein cleaves amyloid precursor protein into amyloid beta peptide, which is a critical step in the etiology of Alzheimer's disease and Down syndrome. The protein precursor is further processed into an active mature peptide. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Protease, Transmembrane |
Protein Pathways | Alzheimer's disease |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408426 | BACE2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC408427 | BACE2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC415975 | BACE2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408426 | Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant c |
USD 665.00 |
|
LY408427 | Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant b |
USD 436.00 |
|
LY415975 | Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a |
USD 436.00 |
|
PH304860 | BACE2 MS Standard C13 and N15-labeled recombinant protein (NP_036237) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review