GTL3 (CFAP20) (NM_013242) Human Recombinant Protein
CAT#: TP301017
Recombinant protein of human chromosome 16 open reading frame 80 (C16orf80), 20 µg
View other "GTL3" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201017 protein sequence
Red=Cloning site Green=Tags(s) MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLG IKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFT RRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037374 |
Locus ID | 29105 |
UniProt ID | Q9Y6A4 |
Cytogenetics | 16q21 |
Refseq Size | 1308 |
Refseq ORF | 579 |
Synonyms | BUG22; C16orf80; EVORF; fSAP23; GTL3 |
Summary | Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia (PubMed:24414207). Required for axonemal microtubules polyglutamylation (PubMed:24414207).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415720 | CFAP20 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY415720 | Transient overexpression lysate of chromosome 16 open reading frame 80 (C16orf80) |
USD 436.00 |
|
PH301017 | C16orf80 MS Standard C13 and N15-labeled recombinant protein (NP_037374) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review