Antibodies

View as table Download

Rabbit Polyclonal Anti-NKAIN4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NKAIN4 antibody: synthetic peptide directed towards the N terminal of human NKAIN4. Synthetic peptide located within the following region: MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILG

Rabbit Polyclonal Anti-NKAIN4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NKAIN4 antibody: synthetic peptide directed towards the middle region of human NKAIN4. Synthetic peptide located within the following region: LLGFVCGCQVVSVFTDEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQVYLP