Antibodies

Jump to Filters
View as table Download
LXR alpha (NR1H3) Mouse Monoclonal Antibody [Clone ID: OTI1A5]
TA805015

USD 447.00

In Stock

NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
LXR alpha (NR1H3) Mouse Monoclonal Antibody [Clone ID: OTI1A5]
CF805015

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
LXR alpha (NR1H3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A5]
TA805015AM

USD 509.00

2 Weeks

NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
LXR alpha (NR1H3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A5]
TA805015BM

USD 509.00

2 Weeks

NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
LXR alpha (NR1H3) Mouse Monoclonal Antibody [Clone ID: OTI1A5]
TA805015S

USD 200.00

2 Days

NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

LXR alpha (NR1H3) Mouse Monoclonal Antibody [Clone ID: OTI1F5]
CF805049

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) NR1H3 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
LXR alpha (NR1H3) Rabbit Polyclonal Antibody
TA325122

USD 580.00

5 Days

Rabbit polyclonal NR1H3 Antibody (Center)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NR1H3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 226-253 amino acids from the Central region of human NR1H3.
LXR alpha (NR1H3) Mouse Monoclonal Antibody [Clone ID: OTI1F5]
TA805049S

USD 200.00

2 Days

NR1H3 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

LXR alpha (NR1H3) Rabbit Polyclonal Antibody
TA301491

USD 550.00

5 Days

Rabbit Polyclonal Antibody against Liver X Receptor

Applications Simple Western, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human LXR protein sequence (between residues 50-150).
LXR alpha (NR1H3) Rabbit Polyclonal Antibody
TA343557

USD 485.00

5 Days

Rabbit Polyclonal Anti-NR1H3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1H3 antibody: synthetic peptide directed towards the N terminal of human NR1H3. Synthetic peptide located within the following region: MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSA
LXR alpha (NR1H3) (C-term) Rabbit Polyclonal Antibody
AP23389PU-N

USD 560.00

2 Weeks

LXR alpha (NR1H3) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human LXRα, identical to the related rat and mouse sequence.
LXR alpha (NR1H3) Goat Polyclonal Antibody
TA302966

USD 520.00

5 Days

Goat Polyclonal Antibody against NR1H3; NR1H2

Applications WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence CRLQDKKLPPLLSEI, from the internal region of the protein sequence according to NP_005684; NP_009052.