Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal KPNA5 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KPNA5 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human KPNA5. |
Rabbit Polyclonal Anti-KPNA5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KPNA5 antibody: synthetic peptide directed towards the C terminal of human KPNA5. Synthetic peptide located within the following region: TVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIE |
KPNA5 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KPNA5 antibody is: synthetic peptide directed towards the N-terminal region of Human IMA6 |
KPNA5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human KPNA5 (NP_002260.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- KPNA5