Rabbit Polyclonal KPNA5 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal KPNA5 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal KPNA5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KPNA5 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human KPNA5. |
Rabbit Polyclonal KPNA5 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KPNA5 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human KPNA5. |
Rabbit Polyclonal Anti-KPNA5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KPNA5 antibody: synthetic peptide directed towards the C terminal of human KPNA5. Synthetic peptide located within the following region: TVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIE |
KPNA5 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-KPNA5 antibody is: synthetic peptide directed towards the N-terminal region of Human IMA6 |
KPNA5 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human KPNA5 (NP_002260.2). |
Modifications | Unmodified |