Antibodies

Jump to Filters
View as table Download
Factor D (CFD) (N-term) Rabbit Polyclonal Antibody
AP50877PU-N

USD 580.00

2 Weeks

Factor D (CFD) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 75-107 amino acids from the N-terminal region of Human CFD
Factor D (CFD) Rabbit Polyclonal Antibody
TA342870

USD 539.00

5 Days

Rabbit Polyclonal Anti-CFD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CFD antibody: synthetic peptide directed towards the C terminal of human CFD. Synthetic peptide located within the following region: GRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSG