Rabbit Polyclonal Anti-ETFB Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ETFB |
Rabbit Polyclonal Anti-ETFB Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ETFB |
ETFB rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ETFB |
ETFB rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ETFB |
ETFB Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 80-230 of human ETFB (NP_001976.1). |
Modifications | Unmodified |
Rabbit Polyclonal antibody to Beta ETF (electron-transfer-flavoprotein, beta polypeptide)
Applications | IF, WB |
Reactivities | Human, Mouse (Predicted: Monkey, Pig, Rat, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 255 of Beta ETF (Uniprot ID#P38117) |
ETFB rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ETFB |
ETFB (152-165) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Bovine, Canine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence from the internal region (aa 152-165) of the protein sequence according to NP_001976.1 and NP_001014763.1. |
Goat Anti-ETFB (aa 231-243) Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PQRTAGVKVETTE, from the C Terminus of the protein sequence according to NP_001976.1; NP_001014763.1. |
Rabbit Polyclonal Anti-ETFB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ETFB antibody: synthetic peptide directed towards the C terminal of human ETFB. Synthetic peptide located within the following region: TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP |
Rabbit Polyclonal Anti-ETFB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ETFB antibody is: synthetic peptide directed towards the C-terminal region of Human ETFB. Synthetic peptide located within the following region: PQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYAT |
ETFB rabbit polyclonal antibody, Serum
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Cter domain of human ETFB |