Germany
Japan
United Kingdom
China
CDC25B mouse monoclonal antibody,clone OTI6H9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
CDC25B mouse monoclonal antibody,clone OTI11C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CDC25B mouse monoclonal antibody,clone OTI11C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CDC25B mouse monoclonal antibody,clone OTI6H9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
CDC25B mouse monoclonal antibody,clone OTI11C5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
CDC25B mouse monoclonal antibody,clone OTI11C5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 509.00
2 Weeks
CDC25B mouse monoclonal antibody,clone OTI6H9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
CDC25B mouse monoclonal antibody,clone OTI6H9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit Polyclonal Anti-CDC25B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE |
CDC25B mouse monoclonal antibody,clone OTI6H9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CDC25B pSer187 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S187 of human Cdc25B. |
Rabbit Polyclonal Anti-CDC25B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASS |
Active filters
Target Symbol
- CDC25B