Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Cyclin A2 (CCNA2) mouse monoclonal antibody, clone E67, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mink, Monkey, Mouse |
| Conjugation | Unconjugated |
Cyclin A2 (CCNA2) (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human CCNA2. |
Rabbit Polyclonal anti-Ccna2 antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ccna2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPET |
Cyclin A2 (CCNA2) mouse monoclonal antibody, clone E67, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mink, Monkey, Mouse |
| Conjugation | Unconjugated |
Cyclin A2 Rabbit polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Cyclin A2 (NP_001228.1). |
| Modifications | Unmodified |
Cyclin A2 (CCNA2) (N-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide at the N-term of human CCNA2. |
Active filters
Target Symbol
- CCNA2