SLC34A3 (NM_080877) Human Recombinant Protein
CAT#: TP322058
Purified recombinant protein of Homo sapiens solute carrier family 34 (sodium phosphate), member 3 (SLC34A3), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222058 representing NM_080877
Red=Cloning site Green=Tags(s) MPSSLPGSQVPHPTLDAVDLVEKTLRNEGTSSSAPVLEEGDTDPWTLPQLKDTSQPWKELRVAGRLRRVA GSVLKACGLLGSLYFFICSLDVLSSAFQLLGSKVAGDIFKDNVVLSNPVAGLVIGVLVTALVQSSSTSSS IVVSMVAAKLLTVRVSVPIIMGVNVGTSITSTLVSMAQSGDRDEFQRAFSGSAVHGIFNWLTVLVLLPLE SATALLERLSELALGAASLTPRAQAPDILKVLTKPLTHLIVQLDSDMIMSSATGNATNSSLIKHWCGTTG QPTQENSSCGAFGPCTEKNSTAPADRLPCRHLFAGTELTDLAVGCILLAGSLLVLCGCLVLIVKLLNSVL RGRVAQVVRTVINADFPFPLGWLGGYLAVLAGAGLTFALQSSSVFTAAVVPLMGVGVISLDRAYPLLLGS NIGTTTTALLAALASPADRMLSALQVALIHFFFNLAGILLWYLVPALRLPIPLARHFGVVTARYRWVAGV YLLLGFLLLPLAAFGLSLAGGMVLAAVGGPLVGLVLLVILVTVLQRRRPAWLPVRLRSWAWLPVWLHSLE PWDRLVTRCCPCNVCSPPKATTKEAYCYENPEILASQQL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 63.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_543153 |
Locus ID | 142680 |
UniProt ID | Q8N130 |
Cytogenetics | 9q34.3 |
Refseq Size | 2124 |
Refseq ORF | 1797 |
Synonyms | HHRH; NPTIIc |
Summary | This gene encodes a member of SLC34A transporter family of proteins, and is expressed primarily in the kidney. It is involved in transporting phosphate into cells via sodium cotransport in the renal brush border membrane, and contributes to the maintenance of inorganic phosphate concentration in the kidney. Mutations in this gene are associated with hereditary hypophosphatemic rickets with hypercalciuria. Alternatively spliced transcript variants varying in the 5' UTR have been found for this gene.[provided by RefSeq, Apr 2010] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408994 | SLC34A3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC433328 | SLC34A3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408994 | Transient overexpression lysate of solute carrier family 34 (sodium phosphate), member 3 (SLC34A3) |
USD 665.00 |
|
LY433328 | Transient overexpression lysate of solute carrier family 34 (sodium phosphate), member 3 (SLC34A3), transcript variant 1 |
USD 436.00 |
|
PH322058 | SLC34A3 MS Standard C13 and N15-labeled recombinant protein (NP_543153) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review