FCRL2 (NM_030764) Human Recombinant Protein
CAT#: TP321878
Recombinant protein of human Fc receptor-like 2 (FCRL2), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221878 representing NM_030764
Red=Cloning site Green=Tags(s) MLLWSLLVIFDAVTEQADSLTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQ SAVLSDSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPVLTASSFQPIEGGPVSLKCETRLSPQRLDVQ LQFCFFRENQVLGSGWSSSPELQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHVQRIPISNVSLEIR APGGQVTEGQKLILLCSVAGGTGNVTFSWYREATGTSMGKKTQRSLSAELEIPAVKESDAGKYYCRADNG HVPIQSKVVNIPVRIPVSRPVLTLRSPGAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSGG GASFNLSLTAEHSGNYSCEANNGLGAQCSEAVPVSISGPDGYRRDLMTAGVLWGLFGVLGFTGVALLLYA LFHKISGESSATNEPRGASRPNPQEFTYSSPTPDMEELQPVYVNVGSVDVDVVYSQVWSMQQPESSANIR TLLENKDSQVIYSSVKKS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_110391 |
Locus ID | 79368 |
UniProt ID | Q96LA5, B4E0W2 |
Cytogenetics | 1q23.1 |
Refseq Size | 2573 |
Refseq ORF | 1524 |
Synonyms | CD307b; FCRH2; IFGP4; IRTA4; SPAP1; SPAP1A; SPAP1B; SPAP1C |
Summary | This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein has four extracellular C2-type immunoglobulin domains, a transmembrane domain and a cytoplasmic domain that contains one immunoreceptor-tyrosine activation motif and two immunoreceptor-tyrosine inhibitory motifs. This protein may be a prognostic marker for chronic lymphocytic leukemia. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Apr 2009] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408502 | FCRL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC410726 | FCRL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY408502 | Transient overexpression lysate of Fc receptor-like 2 (FCRL2), transcript variant 1 |
USD 436.00 |
|
LY410726 | Transient overexpression lysate of Fc receptor-like 2 (FCRL2) |
USD 665.00 |
|
PH321878 | FCRL2 MS Standard C13 and N15-labeled recombinant protein (NP_110391) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review