MFGE8 (NM_005928) Human Recombinant Protein

CAT#: TP317163

Recombinant protein of human milk fat globule-EGF factor 8 protein (MFGE8), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified MFGE8 protein (Cat# TP317163). The protein was produced from HEK293T cells transfected with MFGE8 cDNA clone (Cat# RC217163) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC217163 representing NM_005928
  Red=Cloning site Green=Tags(s)
  
  MPRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKC
  VEPLGLENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTG
  VVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPT
  SCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVA
  GSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDN
  HSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005919
• Locus ID: 4240
• UniProt ID: Q08431
• Cytogenetics: 15q26.1
• Refseq Size: 1934
• Refseq ORF: 1161
• Synonyms: BA46; EDIL1; HMFG; hP47; HsT19888; MFG-E8; MFGM; OAcGD3S; SED1; SPAG10
• Summary: This gene encodes a preproprotein that is proteolytically processed to form multiple protein products. The major encoded protein product, lactadherin, is a membrane glycoprotein that promotes phagocytosis of apoptotic cells. This protein has also been implicated in wound healing, autoimmune disease, and cancer. Lactadherin can be further processed to form a smaller cleavage product, medin, which comprises the major protein component of aortic medial amyloid (AMA). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]