ZNHIT3 (NM_004773) Human Recombinant Protein
CAT#: TP314666
Purified recombinant protein of Homo sapiens zinc finger, HIT type 3 (ZNHIT3), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214666 protein sequence
Red=Cloning site Green=Tags(s) MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDD DDSIADFLNSDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQGEDKAKLMRAYMQEPLFVEFA DCCLGIVEPSQNEES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004764 |
Locus ID | 9326 |
UniProt ID | Q15649, A0A024R0X8 |
Cytogenetics | 17q12 |
Refseq Size | 974 |
Refseq ORF | 465 |
Synonyms | Hit1; PEHO; TRIP3 |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417754 | ZNHIT3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417754 | Transient overexpression lysate of zinc finger, HIT type 3 (ZNHIT3) |
USD 436.00 |
|
PH314666 | ZNHIT3 MS Standard C13 and N15-labeled recombinant protein (NP_004764) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review