Protein C (PROC) (NM_000312) Human Recombinant Protein
CAT#: TP306582L
Recombinant protein of human protein C (inactivator of coagulation factors Va and VIIIa) (PROC), 1 mg
Frequently bought together (2)
Other products for "Protein C"
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206582 protein sequence
Red=Cloning site Green=Tags(s) MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECIEEICDFEEAK EIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQREVSFLNC SLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHLKRDTEDQEDQVDP RLIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDL DIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREK EAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLV SWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000303 |
Locus ID | 5624 |
UniProt ID | P04070 |
Cytogenetics | 2q14.3 |
Refseq Size | 1790 |
Refseq ORF | 1383 |
Synonyms | APC; PC; PROC1; THPH3; THPH4 |
Summary | This gene encodes a vitamin K-dependent plasma glycoprotein. The encoded protein is cleaved to its activated form by the thrombin-thrombomodulin complex. This activated form contains a serine protease domain and functions in degradation of the activated forms of coagulation factors V and VIII. Mutations in this gene have been associated with thrombophilia due to protein C deficiency, neonatal purpura fulminans, and recurrent venous thrombosis.[provided by RefSeq, Dec 2009] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Complement and coagulation cascades |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.