CD27 (NM_001242) Human Recombinant Protein
CAT#: TP304252
Recombinant protein of human CD27 molecule (CD27), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204252 protein sequence
Red=Cloning site Green=Tags(s) MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAAQCDPCIPGVS FSPDHHTRPHCESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTECDPLPNPSLTARSSQALSPHP QPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMFLVFTLAGALF LHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001233 |
Locus ID | 939 |
UniProt ID | P26842 |
Cytogenetics | 12p13.31 |
Refseq Size | 1320 |
Refseq ORF | 780 |
Synonyms | S152; S152. LPFS2; T14; TNFRSF7; Tp55 |
Summary | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400496 | CD27 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400496 | Transient overexpression lysate of CD27 molecule (CD27) |
USD 436.00 |
|
PH304252 | CD27 MS Standard C13 and N15-labeled recombinant protein (NP_001233) |
USD 3,255.00 |
|
TP700286 | Purified recombinant protein of human CD27 molecule (CD27), with C-terminal DDK/His tag, expressed in human cells, 20 µg |
USD 867.00 |
|
TP723936 | Human CD27 Protein, mFc-His Tag |
USD 520.00 |
|
TP724010 | Human CD27 Protein, hFc Tag |
USD 520.00 |
{0} Product Review(s)
Be the first one to submit a review