OCIAD1 (NM_017830) Human Recombinant Protein
CAT#: TP301506
Recombinant protein of human OCIA domain containing 1 (OCIAD1), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201506 protein sequence
Red=Cloning site Green=Tags(s) MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSH PKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSG QSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESY EVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060300 |
Locus ID | 54940 |
UniProt ID | Q9NX40, A0A024R9U3 |
Cytogenetics | 4p11 |
Refseq Size | 2005 |
Refseq ORF | 735 |
Synonyms | ASRIJ; OCIA; TPA018 |
Summary | Maintains stem cell potency (By similarity). Increases STAT3 phosphorylation and controls ERK phosphorylation (By similarity). May act as a scaffold, increasing STAT3 recruitment onto endosomes (By similarity). Involved in integrin-mediated cancer cell adhesion and colony formation in ovarian cancer (PubMed:20515946).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402620 | OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC421553 | OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC421556 | OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402620 | Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 1 |
USD 436.00 |
|
LY421553 | Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 2 |
USD 436.00 |
|
LY421556 | Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 5 |
USD 436.00 |
|
PH301506 | OCIAD1 MS Standard C13 and N15-labeled recombinant protein (NP_060300) |
USD 3,255.00 |
|
PH320792 | OCIAD1 MS Standard C13 and N15-labeled recombinant protein (NP_001073311) |
USD 3,255.00 |
|
TP320792 | Purified recombinant protein of Homo sapiens OCIA domain containing 1 (OCIAD1), transcript variant 5, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review