PPIC (NM_000943) Human Recombinant Protein

CAT#: TP301143L

Recombinant protein of human peptidylprolyl isomerase C (cyclophilin C) (PPIC), 1 mg

Product Images

Coomassie blue staining of purified PPIC protein (Cat# TP301143). The protein was produced from HEK293T cells transfected with PPIC cDNA clone (Cat# RC201143) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201143 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGPGPRLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENF
  VALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPD
  TNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIA
  DW
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000934
• Locus ID: 5480
• UniProt ID: P45877
• Cytogenetics: 5q23.2
• Refseq Size: 1241
• Refseq ORF: 636
• Synonyms: CYPC
• Summary: The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase)) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. Similar to other PPIases, this protein can bind immunosuppressant cyclosporin A. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane