TADA3L (TADA3) (NM_006354) Human Mass Spec Standard
CAT#: PH303687
TADA3 MS Standard C13 and N15-labeled recombinant protein (NP_006345)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203687 |
Predicted MW | 48.9 kDa |
Protein Sequence |
>RC203687 protein sequence
Red=Cloning site Green=Tags(s) MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQI LTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPI DVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQK DGARAAAVADKKKGLMGPLTELDTKDVDALLKKSEAQHEQPEDGCPFGALTQRLLQALVEENIISPMEDS PIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQ AELKALSAHNRTKKHDLLRLAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTL KERESILKLLDG TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006345 |
RefSeq Size | 2530 |
RefSeq ORF | 1296 |
Synonyms | ADA3; hADA3; NGG1; STAF54; TADA3L |
Locus ID | 10474 |
UniProt ID | O75528, A8K899 |
Cytogenetics | 3p25.3 |
Summary | DNA-binding transcriptional activator proteins increase the rate of transcription by interacting with the transcriptional machinery bound to the basal promoter in conjunction with adaptor proteins, possibly by acetylation and destabilization of nucleosomes. The protein encoded by this gene is a transcriptional activator adaptor and a component of the histone acetyl transferase (HAT) coactivator complex which plays a crucial role in chromatin modulation and cell cycle progression. Along with the other components of the complex, this protein links transcriptional activators bound to specific promoters, to histone acetylation and the transcriptional machinery. The protein is also involved in the stabilization and activation of the p53 tumor suppressor protein that plays a role in the cellular response to DNA damage. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401911 | TADA3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC408813 | TADA3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401911 | Transient overexpression lysate of transcriptional adaptor 3 (TADA3), transcript variant 1 |
USD 436.00 |
|
LY408813 | Transient overexpression lysate of transcriptional adaptor 3 (TADA3), transcript variant 2 |
USD 436.00 |
|
PH301082 | TADA3 MS Standard C13 and N15-labeled recombinant protein (NP_597814) |
USD 3,255.00 |
|
TP301082 | Recombinant protein of human transcriptional adaptor 3 (NGG1 homolog, yeast)-like (TADA3L), transcript variant 2, 20 µg |
USD 867.00 |
|
TP303687 | Recombinant protein of human transcriptional adaptor 3 (NGG1 homolog, yeast)-like (TADA3L), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review