Cebpa (NM_001287579) Rat Tagged ORF Clone

CAT#: RR216117

Cebpa (myc-DDK-tagged) - Rat CCAAT/enhancer binding protein (C/EBP), alpha (Cebpa), transcript variant 1

Product Images

Circular map for RR216117

Specifications

Product Data

• Type: Rat Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Cebpa
• Synonyms: DBPCEP
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RR216117 representing NM_001287579
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCCGCGGGGGCGCACGGACCCCCTCCCGGCTACGGCTGTGCGGCGGCCGGCTACCTGGACGGCAGGC
  TGGAGCCCCTGTACGAGCGCGTCGGGGCGCCCGCGCTGCGGCCGCTGGTGATCAAGCAGGAGCCCCGCGA
  GGAGGACGAGGCGAAGCAGCTGGCGCTGGCCGGCCTCTTCCCCTATCAGCCCCCGCCGCCGCCGCCGCCA
  CCGCACCCGCACGCGTCTCCCGCGCACTTGGCCGCCCCTCACTTGCAGTTCCAGATCGCACACTGCGGCC
  AGACCACCATGCACCTGCAGCCTGGCCACCCTACGCCGCCGCCGACGCCCGTGCCCAGCCCTCATCCCGC
  GCCTGCAATGGGTGCTGCGGGCCTGCCGGGCCCCGGGGGCTCGCTCAAGGGCTTGGCTGGTCCGCACCCC
  GACCTCCGCACCGGCGGCGGCGGCGGCGGCGGGGCCGGCGCGGGCAAGGCCAAGAAGTCGGTGGATAAGA
  ACAGCAACGAGTACCGGGTACGGCGGGAACGCAACAACATCGCGGTGCGCAAGAGCCGAGATAAAGCCAA
  ACAGCGCAACGTGGAGACGCAGCAGAAGGTGTTGGAGTTGACCAGTGACAATGACCGCCTGCGCAAGCGG
  GTGGAACAGCTGAGCCGTGAACTGGACACGCTGCGGGGTATCTTCCGCCAGCTGCCTGAGAGCTCCTTGG
  TCAAGGCCATGGGCAACTGCGCG
  
  AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
  TGGATTACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RR216117 representing NM_001287579
  Red=Cloning site Green=Tags(s)
  
  MSAGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPP
  PHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPAMGAAGLPGPGGSLKGLAGPHP
  DLRTGGGGGGGAGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKR
  VEQLSRELDTLRGIFRQLPESSLVKAMGNCA
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Restriction Sites: SgfI-RsrII Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001287579
• ORF Size: 723 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001287579.1, NP_001274508.1
• RefSeq Size: 2673 bp
• RefSeq ORF: 726 bp
• Locus ID: 24252
• UniProt ID: P05554
• Cytogenetics: 1q21
• MW: 25.5 kDa
• Gene Summary: This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain and recognizes the CCAAT motif in the promoters of target genes. The encoded protein functions in homodimers and also heterodimers with CCAAT/enhancer-binding proteins beta and gamma. Activity of this protein can modulate the expression of genes involved in cell cycle regulation as well as in body weight homeostasis. The use of alternative in-frame non-AUG (CUG) and AUG start codons results in protein isoforms with different lengths. Differential translation initiation is mediated by an out-of-frame, upstream open reading frame which is located between the CUG and the first AUG start codons. [provided by RefSeq, Aug 2014]