CRISP3 (NM_006061) Human Tagged ORF Clone

CAT#: RC210193

CRISP3 (Myc-DDK-tagged)-Human cysteine-rich secretory protein 3 (CRISP3), transcript variant 1

Product Images

Circular map for RC210193

• 

  Western blot validation of overexpression lysate (Cat# LY416894) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC210193 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: CRISP3
• Synonyms: Aeg2; CRISP-3; CRS3; dJ442L6.3; SGP28
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC210193 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGACATTATTCCCAGTGCTGTTGTTCCTGGTTGCTGGGCTGCTTCCATCTTTTCCAGCAAATGAAGATA
  AGGATCCCGCTTTTACTGCTTTGTTAACCACCCAAACACAAGTGCAAAGGGAGATTGTGAATAAGCACAA
  TGAACTGAGGAGAGCAGTATCTCCCCCTGCCAGAAACATGCTGAAGATGGAATGGAACAAAGAGGCTGCA
  GCAAATGCCCAAAAGTGGGCAAACCAGTGCAATTACAGACACAGTAACCCAAAGGATCGAATGACAAGTC
  TAAAATGTGGTGAGAATCTCTACATGTCAAGTGCCTCCAGCTCATGGTCACAAGCAATCCAAAGCTGGTT
  TGATGAGTACAATGATTTTGACTTTGGTGTAGGGCCAAAGACTCCCAACGCAGTGGTTGGACATTATACA
  CAGGTTGTTTGGTACTCTTCATACCTCGTTGGATGTGGAAATGCCTACTGTCCCAATCAAAAAGTTCTAA
  AATACTACTATGTTTGCCAATATTGTCCTGCTGGTAATTGGGCTAATAGACTATATGTCCCTTATGAACA
  AGGAGCACCTTGTGCCAGTTGCCCAGATAACTGTGACGATGGACTATGCACCAATGGTTGCAAGTACGAA
  GATCTCTATAGTAACTGTAAAAGTTTGAAGCTCACATTAACCTGTAAACATCAGTTGGTCAGGGACAGTT
  GCAAGGCCTCCTGCAATTGTTCAAACAGCATTTAT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC210193 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTLFPVLLFLVAGLLPSFPANEDKDPAFTALLTTQTQVQREIVNKHNELRRAVSPPARNMLKMEWNKEAA
  ANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSASSSWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYT
  QVVWYSSYLVGCGNAYCPNQKVLKYYYVCQYCPAGNWANRLYVPYEQGAPCASCPDNCDDGLCTNGCKYE
  DLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNSIY
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_006061
• ORF Size: 735 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_006061.1, NP_006052.1
• RefSeq Size: 2219 bp
• RefSeq ORF: 777 bp
• Locus ID: 10321
• UniProt ID: P54108
• Cytogenetics: 6p12.3
• Domains: SCP
• Protein Families: Secreted Protein
• MW: 27.6 kDa
• Gene Summary: This gene encodes a member of the cysteine-rich secretory protein (CRISP) family within the CRISP, antigen 5 and pathogenesis-related 1 proteins superfamily. The encoded protein has an N-terminal CRISP, antigen 5 and pathogenesis-related 1 proteins domain, a hinge region, and a C-terminal ion channel regulator domain. This protein contains cysteine residues, located in both the N- and C-terminal domains, that form eight disulfide bonds, a distinguishing characteristic of this family. This gene is expressed in the male reproductive tract where it plays a role in sperm function and fertilization, and the female reproductive tract where it plays a role in endometrial receptivity for embryo implantation. This gene is upregulated in certain types of prostate cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2016]