NDUFS7 (NM_024407) Human Tagged ORF Clone

CAT#: RC203279

NDUFS7 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Q reductase) (NDUFS7), nuclear gene encoding mitochondrial protein

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_024407" in other vectors (4)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


NDUFS7 rabbit polyclonal antibody
    • 100 ul

USD 380.00

Other products for "NDUFS7"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NDUFS7
Synonyms CI-20; CI-20KD; MC1DN3; MY017; PSST
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203279 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGTGCTGTCAGCTCCTGGCCTGCGCGGCTTCCGGATCCTTGGTCTGCGCTCCAGCGTGGGCCTGG
CTGTGCAGGCACGAGGTGTCCATCAGAGCGTGGCCACCGATGGCCCAAGCAGCACCCAGCCTGCCCTGCC
AAAGGCCAGAGCCGTGGCTCCCAAACCCAGCAGCCGGGGCGAGTATGTGGTGGCCAAGCTGGATGACCTC
GTCAACTGGGCCCGCCGGAGTTCTCTGTGGCCCATGACCTTCGGCCTGGCCTGCTGCGCCGTGGAGATGA
TGCACATGGCAGCACCCCGCTACGACATGGACCGCTTTGGCGTGGTCTTCCGCGCCAGCCCGCGCCAGTC
CGACGTCATGATCGTGGCCGGCACACTCACCAACAAGATGGCCCCAGCGCTTCGCAAGGTCTACGACCAG
ATGCCGGAGCCGCGCTACGTGGTCTCCATGGGGAGCTGCGCCAACGGAGGAGGCTACTACCACTATTCCT
ACTCGGTGGTGAGGGGCTGCGACCGCATCGTGCCCGTGGACATCTACATCCCAGGCTGCCCACCTACGGC
CGAGGCCCTGCTCTACGGCATCCTGCAGCTGCAGAGGAAGATCAAGCGGGAGCGGAGGCTGCAGATCTGG
TACCGCAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203279 protein sequence
Red=Cloning site Green=Tags(s)

MAVLSAPGLRGFRILGLRSSVGLAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRGEYVVAKLDDL
VNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQ
MPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIW
YRR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_024407
ORF Size 639 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_024407.3, NP_077718.2
RefSeq Size 799 bp
RefSeq ORF 642 bp
Locus ID 374291
UniProt ID O75251
Cytogenetics 19p13.3
Domains oxidored_q6
Protein Pathways Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
MW 23.6 kDa
Gene Summary This gene encodes a protein that is a subunit of one of the complexes that forms the mitochondrial respiratory chain. This protein is one of over 40 subunits found in complex I, the nicotinamide adenine dinucleotide (NADH):ubiquinone oxidoreductase. This complex functions in the transfer of electrons from NADH to the respiratory chain, and ubiquinone is believed to be the immediate electron acceptor for the enzyme. Mutations in this gene cause Leigh syndrome due to mitochondrial complex I deficiency, a severe neurological disorder that results in bilaterally symmetrical necrotic lesions in subcortical brain regions. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.