Il17f (NM_145856) Mouse Tagged ORF Clone

CAT#: MR225847

Il17f (Myc-DDK-tagged) - Mouse interleukin 17F (Il17f)

Product Images

Circular map for MR225847

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Il17f
• Synonyms: C87042; IL-17F
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR225847 representing NM_145856
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAAGTGCACCCGTGAAACAGCCATGGTCAAGTCTTTGCTACTGTTGATGTTGGGACTTGCCATTCTGA
  GGGAGGTAGCAGCTCGGAAGAACCCCAAAGCAGGGGTTCCTGCCTTGCAGAAGGCTGGGAACTGTCCTCC
  CCTGGAGGATAACACTGTGAGAGTTGACATTCGAATCTTCAACCAAAACCAGGGCATTTCTGTCCCACGT
  GAATTCCAGAACCGCTCCAGTTCCCCATGGGATTACAACATCACTCGAGACCCCCACCGGTTCCCCTCAG
  AGATCGCTGAGGCCCAGTGCAGACACTCAGGCTGCATCAATGCCCAGGGTCAGGAAGACAGCACCATGAA
  CTCCGTCGCCATTCAGCAAGAAATCCTGGTCCTTCGGAGGGAGCCCCAGGGCTGTTCTAATTCCTTCAGG
  TTGGAGAAGATGCTCCTAAAAGTTGGCTGCACCTGTGTCAAGCCCATTGTCCACCAAGCGGCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR225847 representing NM_145856
  Red=Cloning site Green=Tags(s)
  
  MKCTRETAMVKSLLLLMLGLAILREVAARKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPR
  EFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFR
  LEKMLLKVGCTCVKPIVHQAA
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_145856
• ORF Size: 483 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_145856.2, NP_665855.2
• RefSeq Size: 1178 bp
• RefSeq ORF: 486 bp
• Locus ID: 257630
• UniProt ID: Q7TNI7
• Cytogenetics: 1 A4
• MW: 18.4 kDa
• Gene Summary: Ligand for IL17RA and IL17RC (PubMed:17911633). The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC (By similarity). Involved in stimulating the production of other cytokines such as IL6, IL8 and CSF2, and in regulation of cartilage matrix turnover. Also involved in stimulating the proliferation of peripheral blood mononuclear cells and T-cells and in inhibition of angiogenesis (By similarity). Plays a role in the induction of neutrophilia in the lungs and in the exacerbation of antigen-induced pulmonary allergic inflammation (PubMed:15477493).[UniProtKB/Swiss-Prot Function]