LZTFL1 Rabbit Polyclonal Antibody

CAT#: TA346633

Rabbit Polyclonal Anti-LZTFL1 Antibody

Product Images

WB Suggested Anti-LZTFL1 Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysateLZTFL1 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LZTFL1 antibody: synthetic peptide directed towards the C terminal of human LZTFL1. Synthetic peptide located within the following region: VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: leucine zipper transcription factor like 1
• Database Link:
  NP_065080
  Entrez Gene 54585 Human
  UniProt ID Q9NQ48
• Background: This gene encodes a ubiquitously expressed protein that localizes to the cytoplasm. This protein interacts with Bardet-Biedl Syndrome (BBS) proteins and, through its interaction with BBS protein complexes, regulates protein trafficking to the ciliary membrane. Nonsense mutations in this gene cause a form of Bardet-Biedl Syndrome; a ciliopathy characterized in part by polydactyly, obesity, cognitive impairment, hypogonadism, and kidney failure. This gene may also function as a tumor suppressor; possibly by interacting with E-cadherin and the actin cytoskeleton and thereby regulating the transition of epithelial cells to mesenchymal cells. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Feb 2013]
• Synonyms: BBS17
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%; Rabbit: 93%; Zebrafish: 92%; Dog: 86%; Guinea pig: 79%

Reference Data

• Protein Families: Transcription Factors