Germany
Japan
United Kingdom
China
cvHSP (HSPB7) Rabbit Polyclonal Antibody
Product Images
USD 436.00
USD 200.00
USD 867.00
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Mouse |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Hspb7 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FGSFMLPHSEPLAFPARPGGQGNIKTLGDAYEFTVDMRDFSPEDIIVTTF |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 19 kDa |
| Gene Name | heat shock protein family B (small) member 7 |
| Database Link | |
| Background | The function of Hspb7 remains unknown. |
| Synonyms | cvHSP |
| Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 92%; Rat: 92%; Horse: 90%; Rabbit: 85%; Guinea pig: 85% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
Be the first one to submit a review
