SFRS3 (SRSF3) Rabbit Polyclonal Antibody

CAT#: TA345823

Rabbit Polyclonal Anti-SFRS3 Antibody

Product Images

WB Suggested Anti-SFRS3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SFRS3 antibody: synthetic peptide directed towards the N terminal of human SFRS3. Synthetic peptide located within the following region: SVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: serine/arginine-rich splicing factor 3
• Database Link:
  NP_003008
  Entrez Gene 6428 Human
  UniProt ID P84103
• Background: SFRS3 belongs to the splicing factor SR family. It contains 1 RRM (RNA recognition motif) domain. It may be involved in RNA processing in relation with cellular proliferation and/or maturation.
• Synonyms: SFRS3; SRp20
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Goat: 86%

Reference Data

• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Spliceosome