Zinc finger MIZ domain containing protein 1 (ZMIZ1) Rabbit Polyclonal Antibody

CAT#: TA345286

Rabbit Polyclonal Anti-ZMIZ1 Antibody

Product Images

Lanes: Lane 1: 50ug mouse retina extract; Lane 2: 50ug mouse prostate extract; Lane 3: 50ug mouse testis extract; Lane 4: 50ug mouse colon extract; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-rabbit HRP; Secondary Antibody Dilution: 1: 10, 000; Gene Name: ZMIZ1; Submitted by: John Fu, UVA;

• 

  WB Suggested Anti-ZMIZ1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZMIZ1 antibody: synthetic peptide directed towards the N terminal of human ZMIZ1. Synthetic peptide located within the following region: MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 115 kDa
• Gene Name: zinc finger MIZ-type containing 1
• Database Link:
  NP_065071
  Entrez Gene 328365 MouseEntrez Gene 57178 Human
  UniProt ID Q9ULJ6
• Background: ZMIZ1 increases ligand-dependent transcriptional activity of AR and promotes AR sumoylation. The stimulation of AR activity is dependent upon sumoylation.
• Synonyms: hZIMP10; MIZ; RAI17; TRAFIP10; ZIMP10
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 82%