TRAPPC2L Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of trafficking protein particle complex 2-like (TRAPPC2L)
USD 436.00
Recombinant protein of human trafficking protein particle complex 2-like (TRAPPC2L), 20 µg
USD 867.00
Other products for "TRAPPC2L"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TRAPPC2L antibody: synthetic peptide directed towards the N terminal of human TRAPPC2L. Synthetic peptide located within the following region: MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKAL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 16 kDa |
Gene Name | trafficking protein particle complex 2-like |
Database Link | |
Background | TRAPPC2L may play a role in vesicular transport from endoplasmic reticulum to Golgi. |
Synonyms | HSPC176 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.