EXOC1 Rabbit Polyclonal Antibody

CAT#: TA344612

Rabbit Polyclonal Anti-EXOC1 Antibody - N-terminal region


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Transient overexpression lysate of exocyst complex component 1 (EXOC1), transcript variant 3
    • 100 ug

USD 436.00

Other products for "EXOC1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-EXOC1 antibody: synthetic peptide directed towards the N terminal of human EXOC1. Synthetic peptide located within the following region: NVSSQLLEESVPSGENQSVTGGDEEVVDEYQELNAREEQDIEIMMEGCEY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 100 kDa
Gene Name exocyst complex component 1
Background The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of the exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Synonyms BM-102; SEC3; SEC3L1; SEC3P
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Zebrafish: 85%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.