NIP7 Rabbit Polyclonal Antibody

CAT#: TA343841

Rabbit Polyclonal Anti-NIP7 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of nuclear import 7 homolog (S. cerevisiae) (NIP7)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human nuclear import 7 homolog (S. cerevisiae) (NIP7), 20 µg
    • 20 ug

USD 867.00

Other products for "NIP7"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NIP7 antibody: synthetic peptide directed towards the middle region of human NIP7. Synthetic peptide located within the following region: PGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKST
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 20 kDa
Gene Name NIP7, nucleolar pre-rRNA processing protein
Background NIP7 contains 1PUA domain and belongs to the NIP7 family. It may play a role in 60S ribosomal subunit synthesis.
Synonyms CGI-37; HSPC031; KD93
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.