Germany
Japan
United Kingdom
China
PPAR delta (PPARD) Rabbit Polyclonal Antibody
Product Images
USD 665.00
USD 200.00
USD 867.00
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommended Dilution | WB, IHC |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-PPARD antibody: synthetic peptide directed towards the C terminal of human PPARD. Synthetic peptide located within the following region: AQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 49 kDa |
| Gene Name | peroxisome proliferator activated receptor delta |
| Database Link | |
| Background | PPARD is a member of the peroxisome proliferator-activated receptor (PPAR) family. PPARs are nuclear hormone receptors that bind peroxisome proliferators and control the size and number of peroxisomes produced by cells. PPARs mediate a variety of biologic |
| Synonyms | FAAR; NR1C2; NUC1; NUCI; NUCII; PPARB |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 75% |
| Reference Data | |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
| Protein Pathways | Acute myeloid leukemia, Pathways in cancer, PPAR signaling pathway, Wnt signaling pathway |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
Be the first one to submit a review
