TTLL3 Rabbit Polyclonal Antibody

CAT#: TA343263

Rabbit Polyclonal Anti-TTLL3 Antibody

Product Images

WB Suggested Anti-TTLL3 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TTLL3 antibody is: synthetic peptide directed towards the C-terminal region of TTLL3. Synthetic peptide located within the following region: APVGRSRPKANSRPDCDKPRAEACPMKRLSPLKPLPLVGTFQRRRGLGDM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: tubulin tyrosine ligase like 3
• Database Link:
  NP_001021100
  Entrez Gene 26140 Human
  UniProt ID Q9Y4R7
• Background: TTLL3 is a monoglycylase which modifies alpha- and beta-tubulin, generating side chains of glycine on the gamma-carboxyl groups of specific glutamate residues within the C-terminal tail of alpha- and beta-tubulin. It is involved in the side-chain initiation step of the glycylation reaction by adding a single glycine chain to generate monoglycine side chains. It is not involved in elongation step of the polyglycylation reaction.
• Synonyms: HOTTL
• Note: Immunogen Sequence Homology: Human: 100%