COL8A2 Rabbit Polyclonal Antibody

CAT#: TA342821

Rabbit Polyclonal Anti-COL8A2 Antibody

Product Images

WB Suggested Anti-COL8A2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-COL8A2 antibody: synthetic peptide directed towards the middle region of human COL8A2. Synthetic peptide located within the following region: AAGLPGPQGPSGAKGEPGTRGPPGLIGPTGYGMPGLPGPKGDRGPAGVPG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: collagen type VIII alpha 2
• Database Link:
  NP_005193
  Entrez Gene 1296 Human
  UniProt ID P25067
• Background: COL8A2 is the alpha 2 chain of type VIII collagen. The protein is a major component of the basement membrane of the corneal endothelium and forms homo- or heterotrimers with alpha 1 (VIII) type collagens. Defects in this COL8A2 gene are associated with Fuchs endothelial corneal dystrophy and posterior polymorphous corneal dystrophy type 2
• Synonyms: FECD; FECD1; PPCD; PPCD2
• Note: Immunogen Sequence Homology: Human: 100%; Zebrafish: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 92%; Rat: 92%; Mouse: 92%; Goat: 85%

Reference Data

• Protein Families: Druggable Genome