SCAND3 (ZBED9) Rabbit Polyclonal Antibody

CAT#: TA342488

Rabbit Polyclonal Anti-SCAND3 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of SCAN domain containing 3 (SCAND3)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "SCAND3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SCAND3 antibody: synthetic peptide directed towards the C terminal of human SCAND3. Synthetic peptide located within the following region: ETGFSTLSVIKTKHRNSLNIHYPLRVALSSIQPRLDKLTSKKQAHLSH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 152 kDa
Gene Name zinc finger BED-type containing 9
Background The function of SCAND3 has not yet been determined.
Synonyms Buster4; dJ1186N24.3; SCAND3; ZFP38-L; ZNF305P2; ZNF452
Note Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.