PILRA Rabbit Polyclonal Antibody

CAT#: TA341919

Rabbit Polyclonal Anti-PILRA Antibody

Product Images

WB Suggested Anti-PILRA Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PILRA antibody: synthetic peptide directed towards the N terminal of human PILRA. Synthetic peptide located within the following region: IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: paired immunoglobin like type 2 receptor alpha
• Database Link:
  NP_840057
  Entrez Gene 29992 Human
  UniProt ID Q9UKJ1
• Background: Cell signaling pathways rely on a dynamic interaction between activating and inhibiting processes. SHP-1-mediated dephosphorylation of protein tyrosine residues is central toThe regulation of several cell signaling pathways. Two types of inhibitory receptor superfamily members are immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing receptors andTheir non-ITIM-bearing, activating counterparts. Control of cell signaling via SHP-1 is thought to occur through a balance between PILRalpha-mediated inhibition and PILRbeta-mediated activation.These paired immunoglobulin-like receptor genes are located in a tandem head-to-tail orientation on chromosome 7.This particular gene encodesThe ITIM-bearing member ofThe receptor pair, which functions inThe inhibitory role. Alternative splicing has been observed atThis locus and three variants, each encoding a distinct isoform, are described. [provided by RefSeq, Jul 2008]
• Synonyms: FDF03
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane