Ciita Rabbit Polyclonal Antibody

CAT#: TA341750

Rabbit Polyclonal Anti-Ciita Antibody

Product Images

WB Suggested Anti-C2TA Antibody Titration: 0.125 ug/ml; ELISA Titer: 1:62500; Positive Control: NIH/3T3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C2TA antibody: synthetic peptide directed towards the C terminal of mouse C2TA. Synthetic peptide located within the following region: MALWESLQQQGEAQLLQAAEEKFTIEPFKAKSPKDVEDLDRLVQTQRLRN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 119 kDa
• Gene Name: class II transactivator
• Database Link:
  NP_031601
  Entrez Gene 12265 Mouse
  UniProt ID P79621
• Background: Essential for transcriptional activity ofThe HLA class II promoter; activation is viaThe proximal promoter. No DNA binding of in vitro translated CIITA was detected. May act in a coactivator-like fashion through protein-protein interactions by contacting factors binding toThe proximal MHC class II promoter, to elements ofThe transcription machinery, or both. Alternatively it may activate HLA class II transcription by modifying proteins that bind toThe MHC class II promoter. Also mediates enhanced MHC class I transcription,The promoter element requirements for CIITA-mediated transcription are distinct from those of constitutive MHC class I transcription, and CIITA can functionally replace TAF1 atThese genes. Exhibits intrinsic GTP-stimulated acetyltransferase activity. Exhibits serine/threonine protein kinase activity: phosphorylatesThe TFIID component TAF7,The RAP74 subunit ofThe general transcription factor TFIIF, histone H2B at 'Ser-37' and other histones.
• Synonyms: C2TA; CIITAIV; MHC2TA; NLRA
• Note: Immunogen Sequence Homology: Dog: 100%; Mouse: 100%; Rat: 93%; Human: 79%