NOTO Rabbit Polyclonal Antibody
Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "NOTO"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Noto antibody: synthetic peptide directed towards the n terminal of mouse Noto. Synthetic peptide located within the following region: VQPGSLRPCPGAVSPVVPRRLARGRLESSFSVEAILARPKTRELAATSLP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 26 kDa |
Gene Name | notochord homeobox |
Database Link | |
Background | Noto is a transcription regulator acting downstream of both FOXA2 and T during notochord development.Noto is required for node morphogenesis.Noto is essential for cilia formation inThe posterior notochord (PNC) and for left-right patterning; acts upstream of FOXJ1 and RFX3 inThis process and is required forThe expression of various components important for axonemal assembly and function. Plays a role in regulating axial versus paraxial cell fate. |
Synonyms | Noto |
Note | Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Pig: 93%; Human: 93%; Guinea pig: 93%; Rabbit: 92%; Bovine: 86%; Dog: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.