NOTO Rabbit Polyclonal Antibody

CAT#: TA341740

Rabbit Polyclonal Anti-Noto Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of notochord homeobox (NOTO)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "NOTO"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Noto antibody: synthetic peptide directed towards the n terminal of mouse Noto. Synthetic peptide located within the following region: VQPGSLRPCPGAVSPVVPRRLARGRLESSFSVEAILARPKTRELAATSLP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 26 kDa
Gene Name notochord homeobox
Background Noto is a transcription regulator acting downstream of both FOXA2 and T during notochord development.Noto is required for node morphogenesis.Noto is essential for cilia formation inThe posterior notochord (PNC) and for left-right patterning; acts upstream of FOXJ1 and RFX3 inThis process and is required forThe expression of various components important for axonemal assembly and function. Plays a role in regulating axial versus paraxial cell fate.
Synonyms Noto
Note Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Pig: 93%; Human: 93%; Guinea pig: 93%; Rabbit: 92%; Bovine: 86%; Dog: 85%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.