ADAR1 (ADAR) Rabbit Polyclonal Antibody
USD 436.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ADAR antibody: synthetic peptide directed towards the N terminal of human ADAR. Synthetic peptide located within the following region: GEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 136 kDa |
Gene Name | adenosine deaminase, RNA-specific |
Database Link | |
Background | This gene encodes a protein that sorts transmembrane proteins into lysosomes/vacuoles viaThe multivesicular body (MVB) pathway.This protein, along with other soluble coiled-coil containing proteins, forms part ofThe ESCRT-III protein complex that binds toThe endosomal membrane and recruits additional cofactors for protein sorting intoThe MVB.This protein may also co-immunoprecipitate with a member ofThe IFG-binding protein superfamily. Alternative splicing results in multiple transcript variants. Read-through transcription also exists betweenThis gene andThe upstream ring finger protein 103 (RNF103) gene. [provided by RefSeq, Nov 2010] |
Synonyms | ADAR1; AGS6; DRADA; DSH; DSRAD; G1P1; IFI-4; IFI4; K88DSRBP; P136 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Cytosolic DNA-sensing pathway |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review