C1orf83 (TCEANC2) Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human chromosome 1 open reading frame 83 (C1orf83), 20 µg
USD 867.00
Other products for "C1orf83"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-C1orf83 antibody: synthetic peptide directed towards the N terminal of human C1orf83. Synthetic peptide located within the following region: MDKFVIRTPRIQNSPQKKDSGGKVYKQATIESLKRVVVVEDIKRWKTMLE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 24 kDa |
Gene Name | transcription elongation factor A N-terminal and central domain containing 2 |
Database Link | |
Background | C1orf83 contains 1 TFIIS central domain and 1 TFIIS N-terminal domain. The exact functions of C1orf83 remain unknown.. |
Synonyms | C1orf83 |
Note | Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Rabbit: 85% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.