PYGO1 Rabbit Polyclonal Antibody

CAT#: TA339720

Rabbit Polyclonal Anti-PYGO1 Antibody

Product Images

WB Suggested Anti-PYGO1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PYGO1 antibody: synthetic peptide directed towards the N terminal of human PYGO1. Synthetic peptide located within the following region: GGPGVQLGSPDKKKRKANTQGPSFPPLSEYAPPPNPNSDHLVAANPFDDN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: pygopus family PHD finger 1
• Database Link:
  NP_056432
  Entrez Gene 26108 Human
  UniProt ID Q9Y3Y4
• Background: PYGO1 contains 1 PHD-type zinc finger. PYGO1 is involved in signal transduction through the Wnt pathway.
• Synonyms: DKFZp547G0910
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome