PWP1 Rabbit Polyclonal Antibody

CAT#: TA339707

Rabbit Polyclonal Anti-PWP1 Antibody

Product Images

WB Suggested Anti-PWP1 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PWP1 antibody: synthetic peptide directed towards the C terminal of human PWP1. Synthetic peptide located within the following region: FCSSCCPDLPFIYAFGGQKEGLRVWDISTVSSVNEAFGRRERLVLGSARN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: PWP1 homolog, endonuclein
• Database Link:
  NP_008993
  Entrez Gene 11137 Human
  UniProt ID Q13610
• Background: PWP1 belongs to the WD repeat PWP1 family. It contains 5 WD repeats. PWP1 may play an important role in cell growth and/or transcription.
• Synonyms: IEF-SSP-9502
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors