GSDME Rabbit Polyclonal Antibody

CAT#: TA339270

Rabbit Polyclonal Anti-DFNA5 Antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human deafness, autosomal dominant 5 (DFNA5), transcript variant 1, 20 µg
    • 20 ug

USD 867.00


Transient overexpression lysate of deafness, autosomal dominant 5 (DFNA5), transcript variant 1
    • 100 ug

USD 436.00

Other products for "GSDME"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DFNA5 antibody: synthetic peptide directed towards the C terminal of human DFNA5. Synthetic peptide located within the following region: AALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 47 kDa
Gene Name DFNA5, deafness associated tumor suppressor
Background Hearing impairment is a heterogeneous condition with over 40 loci described. The protein encoded by this gene is expressed in fetal cochlea, however, its function is not known. Nonsyndromic hearing impairment is associated with a mutation in this gene. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Synonyms ICERE-1
Note Immunogen Sequence Homology: Human: 100%; Rat: 85%; Bovine: 85%; Pig: 83%; Guinea pig: 83%; Dog: 77%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.