KLHDC5 (KLHL42) Rabbit Polyclonal Antibody

CAT#: TA339242

Rabbit Polyclonal Anti-KLHL42


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of kelch domain containing 5 (KLHDC5)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human kelch domain containing 5 (KLHDC5), 20 µg
    • 20 ug

USD 867.00

Other products for "KLHDC5"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KLHDC5 antibody: synthetic peptide directed towards the middle region of human KLHDC5. Synthetic peptide located within the following region: IVGGCLHELGPNRRSSQSEDMLTVQSYNTVTRQWLYLKENTSKSGLNLTC
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 57 kDa
Gene Name kelch like family member 42
Background KLHL42 contains 1 BTB (POZ) domain and 6 Kelch repeats. It is phosphorylated upon DNA damage, probably by ATM or ATR. The exact functions of KLHL42 remain unknown.
Synonyms Ctb9; KLHDC5
Note Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Bovine: 86%; Rabbit: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.