CCDC19 (CFAP45) Rabbit Polyclonal Antibody

CAT#: TA339191

Rabbit Polyclonal Anti-CCDC19


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of coiled-coil domain containing 19 (CCDC19)
    • 100 ug

USD 665.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "CCDC19"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CCDC19 antibody: synthetic peptide directed towards the N terminal of human CCDC19. Synthetic peptide located within the following region: MPLSTAGILSSSSAASNRSRNKARYRTKAVSSEVDESLFGDIKSPAQGQS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 66 kDa
Gene Name cilia and flagella associated protein 45
Background The function remains unknown.
Synonyms CCDC19; NESG1
Note Immunogen Sequence Homology: Human: 100%; Dog: 85%; Pig: 85%; Rat: 85%; Horse: 85%; Bovine: 85%; Guinea pig: 85%; Yeast: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.