LRRN5 (LRRN2) Rabbit Polyclonal Antibody

CAT#: TA339041

Rabbit Polyclonal Anti-LRRN2 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Transient overexpression lysate of leucine rich repeat neuronal 2 (LRRN2), transcript variant 2
    • 100 ug

USD 436.00

Other products for "LRRN5"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-LRRN2 antibody: synthetic peptide directed towards the middle region of human LRRN2. Synthetic peptide located within the following region: RVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 79 kDa
Gene Name leucine rich repeat neuronal 2
Background The protein encoded by this gene belongs to the leucine-rich repeat superfamily. This gene was found to be amplified and overexpressed in malignant gliomas. The encoded protein has homology with other proteins that function as cell-adhesion molecules or as signal transduction receptors and is a candidate for the target gene in the 1q32.1 amplicon in malignant gliomas. Two alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq, Jul 2008]
Synonyms FIGLER7; GAC1; LRANK1; LRRN5
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%
Reference Data
Protein Families Druggable Genome, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.