Flotillin 1 (FLOT1) Rabbit Polyclonal Antibody

CAT#: TA338139

Rabbit Polyclonal Anti-FLOT1 Antibody

Product Images

WB Suggested Anti-FLOT1 Antibody; Titration: 1.0 ug/ml; Positive Control: Hela Whole cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FLOT1 antibody is: synthetic peptide directed towards the middle region of Human FLOT1. Synthetic peptide located within the following region: IREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: flotillin 1
• Database Link:
  NP_005794
  Entrez Gene 10211 Human
  UniProt ID O75955
• Background: Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. FLOT1 encodes a caveolae-associated, integral membrane protein. The function of flotillin 1 has not been determined.
• Synonyms: flotillin 1; integral membrane component of caveolae; OTTHUMP00000029208
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Goat: 93%; Rabbit: 93%; Zebrafish: 86%

Reference Data

• Protein Pathways: Insulin signaling pathway