LRRTM3 Rabbit Polyclonal Antibody

CAT#: TA337745

Rabbit Polyclonal Anti-LRRTM3 Antibody

Product Images

WB Suggested Anti-LRRTM3 Antibody; Titration: 1.0 ug/ml; Positive Control: 293T Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LRRTM3 antibody is: synthetic peptide directed towards the C-terminal region of Human LRRTM3. Synthetic peptide located within the following region: SLMRRHRKKKRQSLKQMTPSTQEFYVDYKPTNTETSEMLLNGTGPCTYNK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: leucine rich repeat transmembrane neuronal 3
• Database Link:
  NP_821079
  Entrez Gene 347731 Human
  UniProt ID Q86VH5
• Background: LRRTM3 may play a role in the development and maintenance of the vertebrate nervous system.
• Synonyms: MGC131810
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane