Prickle 2 (PRICKLE2) Rabbit Polyclonal Antibody

CAT#: TA337710

Rabbit Polyclonal Anti-PRICKLE2 Antibody

Product Images

WB Suggested Anti-PRICKLE2 Antibody; Titration: 1.0 ug/ml; Positive Control: Jurkat Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRICKLE2 antibody is: synthetic peptide directed towards the C-terminal region of Human PRICKLE2. Synthetic peptide located within the following region: IPQPARLRYVTSDELLHKYSSYGLPKSSTLGGRGQLHSRKRQKSKNCIIS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 95 kDa
• Gene Name: prickle planar cell polarity protein 2
• Database Link:
  NP_942559
  Entrez Gene 166336 Human
  UniProt ID Q7Z3G6
• Background: This gene encodes a homolog of Drosophila prickle. The exact function of this gene is not known, however, studies in mice suggest that it may be involved in seizure prevention. Mutations in this gene are associated with progressive myoclonic epilepsy type 5.
• Synonyms: EPM5
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Pathways: Wnt signaling pathway